PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G01448.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family VOZ
Protein Properties Length: 265aa    MW: 30341.4 Da    PI: 5.7136
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G01448.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ213.36.8e-665819918161
               VOZ  18 rpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsllegetirewl 110
                        paqgse +qdyc+s ha+la  +g p ++pvl  +gi+l d+ l++ l ak+qg++vgipec+gaa +kspwna+elfdlsl ege irewl
  Eucgr.G01448.1.p  58 MPAQGSECFQDYCNSSHADLARSQGGPCMNPVLCTGGISLNDDELLSLLIAKIQGQNVGIPECHGAAIEKSPWNASELFDLSLPEGEHIREWL 150
                       69******************************************************************************************* PP

               VOZ 111 ffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqp 161
                       ffdkprraf+ gn+++rslpdy+gr w++srkq+mk +gg+krs+ymdpqp
  Eucgr.G01448.1.p 151 FFDKPRRAFKRGNKRKRSLPDYRGR-WYQSRKQLMK-LGGHKRSFYMDPQP 199
                       ************************9.*********8.8************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MDSETKIERE ATTELQIDIK LETDIKPEPD IKLETDIKPE PDIKPKPEPD IEGSAQEMPA  60
QGSECFQDYC NSSHADLARS QGGPCMNPVL CTGGISLNDD ELLSLLIAKI QGQNVGIPEC  120
HGAAIEKSPW NASELFDLSL PEGEHIREWL FFDKPRRAFK RGNKRKRSLP DYRGRWYQSR  180
KQLMKLGGHK RSFYMDPQPD YMDPQPLGFF EWHLFEYEVT SSDFCLYKLR AQAHQLCRKR  240
KGMNDSVVDL QKQMEGSPRK FPGY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G01448.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052424.14e-88PREDICTED: transcription factor VOZ1-like isoform X1
RefseqXP_010052430.14e-88PREDICTED: transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ05e-71VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A059BDM41e-156A0A059BDM4_EUCGR; Uncharacterized protein (Fragment)
STRINGVIT_12s0028g02670.t012e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.27e-66vascular plant one zinc finger protein